Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOR1A Peptide - C-terminal region

TOR1A Peptide - C-terminal region

Product Specifications

Product Name Alternative

TOR1A, DQ2, DYT1, TA, TORA

UniProt

O14656

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TOR1A Rabbit Polyclonal Antibody (orb588584) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000104

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FWRSGKQREDIKLKDIEHALSVSVFNNKNSGFWHSSLIDRNLIDYFVPFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNRPB2 Mouse Monoclonal Antibody [Clone ID: OTI3D9]
CF808092 100 µg

SNRPB2 Mouse Monoclonal Antibody [Clone ID: OTI3D9]

Sign In for Pricing
View Details
UCHL5IP (HAUS7) Human qPCR Primer Pair (NM_207107)
HP231350 200 Reactions

UCHL5IP (HAUS7) Human qPCR Primer Pair (NM_207107)

Sign In for Pricing
View Details
FABP2 (Marker of Metastatic Potential in Colorectal Cancer) (CPTC-FABP2-3), CF740 conjugate, 0.1mg/mL
BNC742226-100 1x 100 µL

FABP2 (Marker of Metastatic Potential in Colorectal Cancer) (CPTC-FABP2-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SUPT20HL1 Human Gene Knockout Kit (CRISPR)
KN427073 1 Kit

SUPT20HL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
14Beta-Hydroxy-13-oxo-7-O-(triethylsilyl) Baccatin III 1,14-Carbonate
TRC-H949155-2.5MG 2.5 mg

14Beta-Hydroxy-13-oxo-7-O-(triethylsilyl) Baccatin III 1,14-Carbonate

Sign In for Pricing
View Details
Zfp710 Mouse Gene Knockout Kit (CRISPR)
KN519952 1 Kit

Zfp710 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details