Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOR1A Peptide - C-terminal region

TOR1A Peptide - C-terminal region

Product Specifications

Product Name Alternative

TOR1A, DQ2, DYT1, TA, TORA

UniProt

O14656

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TOR1A Rabbit Polyclonal Antibody (orb588584) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000104

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FWRSGKQREDIKLKDIEHALSVSVFNNKNSGFWHSSLIDRNLIDYFVPFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WT1 (Wilm's Tumor 1) (6F-H2), CF405S conjugate, 0.1mg/mL
BNC040856-100 1x 100 µL

WT1 (Wilm's Tumor 1) (6F-H2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Ileum
CR561541 5 µg

Tissue Total RNA, Ileum

Sign In for Pricing
View Details
Sodium 2-((2-Aminoethyl)amino)ethanesulfonate (50% in Water)
TRC-S612005-50G 50 g

Sodium 2-((2-Aminoethyl)amino)ethanesulfonate (50% in Water)

Sign In for Pricing
View Details
Cytokeratin 17 (E3), 0.2mg/mL
BNUB0158-500 1x 500 µL

Cytokeratin 17 (E3), 0.2mg/mL

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Mouse IFN-γ Antibody[XMG1.2]
E-AB-F1101T-01 50 Tests

Elab Fluor® Violet 610 Anti-Mouse IFN-γ Antibody[XMG1.2]

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Mouse IFN-γ Antibody[XMG1.2]
E-AB-F1101T-02 100 Tests

Elab Fluor® Violet 610 Anti-Mouse IFN-γ Antibody[XMG1.2]

Sign In for Pricing
View Details