Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHC2 Peptide - middle region

PHC2 Peptide - middle region

Product Specifications

Product Name Alternative

PHC2, EDR2, PH2

UniProt

Q8IXK0

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PHC2 Rabbit Polyclonal Antibody (orb588587) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IAPAYAQLQPHQLLPQPSSKHLQPQFVIQQQPQPQQQQPPPQQSRPVLQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human KLK5 Antibody
MBS1569604-01 0.1 mg

Anti-Human KLK5 Antibody

Sign In for Pricing
View Details
Anti-Human KLK5 Antibody
MBS1569604-02 1 mg

Anti-Human KLK5 Antibody

Sign In for Pricing
View Details
Anti-Human KLK5 Antibody
MBS1569604-03 5x 1 mg

Anti-Human KLK5 Antibody

Sign In for Pricing
View Details
Rat Gucy2c protein
orb594988-01 20 µg

Rat Gucy2c protein

Sign In for Pricing
View Details
Rat Gucy2c protein
orb594988-02 100 µg

Rat Gucy2c protein

Sign In for Pricing
View Details
Rat Gucy2c protein
orb594988-03 1 mg

Rat Gucy2c protein

Sign In for Pricing
View Details