Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHC2 Peptide - middle region

PHC2 Peptide - middle region

Product Specifications

Product Name Alternative

PHC2, EDR2, PH2

UniProt

Q8IXK0

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PHC2 Rabbit Polyclonal Antibody (orb588587) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IAPAYAQLQPHQLLPQPSSKHLQPQFVIQQQPQPQQQQPPPQQSRPVLQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Burkholderia pseudomallei Undecaprenyl-diphosphatase 1 (uppP1), partial
MBS1183792-01 1 mg (E-Coli)

Recombinant Burkholderia pseudomallei Undecaprenyl-diphosphatase 1 (uppP1), partial

Sign In for Pricing
View Details
Recombinant Burkholderia pseudomallei Undecaprenyl-diphosphatase 1 (uppP1), partial
MBS1183792-02 1 mg (Yeast)

Recombinant Burkholderia pseudomallei Undecaprenyl-diphosphatase 1 (uppP1), partial

Sign In for Pricing
View Details
MEF2BNB sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2782508 1.0 µg DNA

MEF2BNB sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Ear2 Mouse Gene Knockout Kit (CRISPR)
KN504957 1 Kit

Ear2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Anti-MARCO [PLK1]
orb758872 0.2 mg

Anti-MARCO [PLK1]

Sign In for Pricing
View Details
ALKBH1 Human qPCR Primer Pair (NM_006020)
HP225752 200 Reactions

ALKBH1 Human qPCR Primer Pair (NM_006020)

Sign In for Pricing
View Details