Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHC2 Peptide - middle region

PHC2 Peptide - middle region

Product Specifications

Product Name Alternative

PHC2, EDR2, PH2

UniProt

Q8IXK0

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PHC2 Rabbit Polyclonal Antibody (orb588587) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IAPAYAQLQPHQLLPQPSSKHLQPQFVIQQQPQPQQQQPPPQQSRPVLQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOGAT1 Antibody, Biotin conjugated
A62738-50UG 50 µg

MOGAT1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Sgpl1-set siRNA/shRNA/RNAi Lentivector (Rat)
43638096 4x 500 ng

Sgpl1-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Anti-PHEX Antibody Picoband®
A02078 100 µg/Vial

Anti-PHEX Antibody Picoband®

Sign In for Pricing
View Details
RecR Recombinant Protein
OPCA02128-100UG 100 µg

RecR Recombinant Protein

Sign In for Pricing
View Details
Atp8b3 3'UTR Luciferase Stable Cell Line
TU102369 1.0 mL

Atp8b3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human Growth Arrest Specific Protein 6 (GAS6) ELISA Kit
abx253580-01 96 Tests

Human Growth Arrest Specific Protein 6 (GAS6) ELISA Kit

Sign In for Pricing
View Details