Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EEF2 Peptide - N-terminal region

EEF2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EF2, EF-2, EEF-2, SCA26

UniProt

P13639

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EEF2 Rabbit Polyclonal Antibody (orb327449) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001952

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KLWGDRYFDPANGKFSKSATSPEGKKLPRTFCQLILDPIFKVFDAIMNFK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dipeptide Diaminobutyroyl Benzylamide Diacetate
orb2659941 1 g

Dipeptide Diaminobutyroyl Benzylamide Diacetate

Sign In for Pricing
View Details
Azilsartan-d4
HY-14914S1-01 2 mg

Azilsartan-d4

Sign In for Pricing
View Details
Azilsartan-d4
HY-14914S1-02 5 mg

Azilsartan-d4

Sign In for Pricing
View Details
Recombinant Adenine Phosphoribosyltransferase (APRT)
MBS2009989-01 0.01 mg

Recombinant Adenine Phosphoribosyltransferase (APRT)

Sign In for Pricing
View Details
Recombinant Adenine Phosphoribosyltransferase (APRT)
MBS2009989-02 0.05 mg

Recombinant Adenine Phosphoribosyltransferase (APRT)

Sign In for Pricing
View Details
Recombinant Adenine Phosphoribosyltransferase (APRT)
MBS2009989-03 0.1 mg

Recombinant Adenine Phosphoribosyltransferase (APRT)

Sign In for Pricing
View Details