EEF2 Peptide - N-terminal region
EEF2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
EF2, EF-2, EEF-2, SCA26
UniProt
P13639
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EEF2 Rabbit Polyclonal Antibody (orb327449) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001952
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KLWGDRYFDPANGKFSKSATSPEGKKLPRTFCQLILDPIFKVFDAIMNFK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AMRe04066-01 1 Each
Creatine Kinase B type Rabbit Monoclonal antibody
Sign In for Pricing
View Details AMRe04066-02 50 µL
Creatine Kinase B type Rabbit Monoclonal antibody
Sign In for Pricing
View Details AMRe04066-03 100 µL
Creatine Kinase B type Rabbit Monoclonal antibody
Sign In for Pricing
View Details 
A133208 100 µL
Anti-TMPRSS6 (REGN7999) (Human, Monoclonal, IgG4, kappa)
Sign In for Pricing
View Details