Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFNA3 Peptide - N-terminal region

EFNA3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EFNA3, EFL2, EPLG3, LERK3

UniProt

P52797

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EFNA3 Rabbit Polyclonal Antibody (orb588588) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004943

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C3orf38 Polyclonal Antibody
E-AB-52504-01 20 µL

C3orf38 Polyclonal Antibody

Sign In for Pricing
View Details
C3orf38 Polyclonal Antibody
E-AB-52504-02 60 µL

C3orf38 Polyclonal Antibody

Sign In for Pricing
View Details
C3orf38 Polyclonal Antibody
E-AB-52504-03 120 µL

C3orf38 Polyclonal Antibody

Sign In for Pricing
View Details
C3orf38 Polyclonal Antibody
E-AB-52504-04 200 µL

C3orf38 Polyclonal Antibody

Sign In for Pricing
View Details
Tide Fluor™ 8WS maleimide [TF8WS maleimide] *Near Infrared Emission*
2337-AAT 1 mg

Tide Fluor™ 8WS maleimide [TF8WS maleimide] *Near Infrared Emission*

Sign In for Pricing
View Details
CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2063), CF488A conjugate, 0.1mg/mL
BNC882063-100 1x 100 µL

CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2063), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details