Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EHHADH Peptide - middle region

EHHADH Peptide - middle region

Product Specifications

Product Name Alternative

LBP, ECHD, LBFP, PBFE, FRTS3, L-PBE

UniProt

Q08426

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EHHADH Rabbit Polyclonal Antibody (orb327450) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001957

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VIAVDSDKNQLATANKMITSVLEKEASKMQQSGHPWSGPKPRLTSSVKEL

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROCK2 Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-61567R-BF647-01 20 µL

ROCK2 Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
ROCK2 Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-61567R-BF647-02 100 µL

ROCK2 Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Recombinant ASFV War-118 Protein (aa 1-205)
VAng-2511Lsx-1mg 1 mg

Recombinant ASFV War-118 Protein (aa 1-205)

Sign In for Pricing
View Details
Genorise® Ferret MPO Polyclonal Antibody
GR210019 100 µg

Genorise® Ferret MPO Polyclonal Antibody

Sign In for Pricing
View Details
TRAPPC2P8 Recombinant Protein (Human)
RP102869 100 µg

TRAPPC2P8 Recombinant Protein (Human)

Sign In for Pricing
View Details
SPNR shRNA Plasmid (m)
sc-153774-SH 20 µg

SPNR shRNA Plasmid (m)

Sign In for Pricing
View Details