Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF4E Peptide - N-terminal region

EIF4E Peptide - N-terminal region

Product Specifications

Product Name Alternative

CBP, EIF4F, AUTS19, EIF4E1, eIF-4E, EIF4EL1

UniProt

P06730

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF4E Rabbit Polyclonal Antibody (orb327451) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC25A23 Human shRNA Plasmid Kit (Locus ID 79085)
TR301633 1 Kit

SLC25A23 Human shRNA Plasmid Kit (Locus ID 79085)

Sign In for Pricing
View Details
Nxpe2 Mouse shRNA Plasmid (Locus ID 78252)
TR516857 1 Kit

Nxpe2 Mouse shRNA Plasmid (Locus ID 78252)

Sign In for Pricing
View Details
RuFluor™ succinimidyl ester
1520-AAT 1 mg

RuFluor™ succinimidyl ester

Sign In for Pricing
View Details
TREML2P sgRNA CRISPR Lentivector (Human) (Target 3)
K2459204 1.0 µg DNA

TREML2P sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
RPS24P16 sgRNA CRISPR Lentivector set (Human)
K2046701 3x 1.0 µg

RPS24P16 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Atp6v1c1 3'UTR Lenti-reporter-Luc Vector
12789086 1.0 µg

Atp6v1c1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details