Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF4E Peptide - N-terminal region

EIF4E Peptide - N-terminal region

Product Specifications

Product Name Alternative

CBP, EIF4F, AUTS19, EIF4E1, eIF-4E, EIF4EL1

UniProt

P06730

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF4E Rabbit Polyclonal Antibody (orb327451) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL5P22 3'UTR Lenti-reporter-Luc Vector
41732081 1.0 µg

RPL5P22 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
IFRD1 Rabbit Polyclonal Antibody
orb627933-01 50 µg

IFRD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IFRD1 Rabbit Polyclonal Antibody
orb627933-02 100 µg

IFRD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HOMEZ Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV667219 1.0 µg DNA

HOMEZ Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Sheep Interleukin 23 ELISA Kit
MBS765056-01 48 Well

Sheep Interleukin 23 ELISA Kit

Sign In for Pricing
View Details
Sheep Interleukin 23 ELISA Kit
MBS765056-02 96 Well

Sheep Interleukin 23 ELISA Kit

Sign In for Pricing
View Details