Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELAVL4 Peptide - N-terminal region

ELAVL4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HUD, PNEM

UniProt

P26378

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ELAVL4 Rabbit Polyclonal Antibody (orb327453) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_068771

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSKTNLIVNYLPQNM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX7 (PAX7/497), CF568 conjugate, 0.1mg/mL
BNC680497-500 1x 500 µL

PAX7 (PAX7/497), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ReadiLink™ iFluor® 647 Nick Translation dsDNA Labeling Kit
17405-AAT 20 Reactions

ReadiLink™ iFluor® 647 Nick Translation dsDNA Labeling Kit

Sign In for Pricing
View Details
Human FKBP10 activation kit by CRISPRa
GA111884 1 Kit

Human FKBP10 activation kit by CRISPRa

Sign In for Pricing
View Details
5-O-Benzylbazedoxifene
TRC-B230870-25MG 25 mg

5-O-Benzylbazedoxifene

Sign In for Pricing
View Details
Tylosin 3-Acetate D3
TRC-T947661-5MG 5 mg

Tylosin 3-Acetate D3

Sign In for Pricing
View Details
Ackr4 Mouse Gene Knockout Kit (CRISPR)
KN300719 1 Kit

Ackr4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details