Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELAVL4 Peptide - N-terminal region

ELAVL4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HUD, PNEM

UniProt

P26378

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ELAVL4 Rabbit Polyclonal Antibody (orb327453) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_068771

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSKTNLIVNYLPQNM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LEO1 activation kit by CRISPRa
GA114802 1 Kit

Human LEO1 activation kit by CRISPRa

Sign In for Pricing
View Details
Hydroxy Dabrafenib
TRC-H824995-1MG 1 mg

Hydroxy Dabrafenib

Sign In for Pricing
View Details
6-Fluoro-8-Quinolinesulfonyl Chloride
TRC-F596550-25MG 25 mg

6-Fluoro-8-Quinolinesulfonyl Chloride

Sign In for Pricing
View Details
HMG20A Human Gene Knockout Kit (CRISPR)
KN401894 1 Kit

HMG20A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IFNE1 (IFNE) activation kit by CRISPRa
GA117368 1 Kit

Human IFNE1 (IFNE) activation kit by CRISPRa

Sign In for Pricing
View Details
DTX1 Polyclonal Antibody
E-AB-13192-01 20 µL

DTX1 Polyclonal Antibody

Sign In for Pricing
View Details