Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTTN Peptide - middle region

CTTN Peptide - middle region

Product Specifications

Product Name Alternative

EMS1

UniProt

Q14247

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CTTN Rabbit Polyclonal Antibody (orb588590) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HYPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ALYREF Antibody Picoband®, APC Conjugate
A03580-3-APC 100 µg/Vial

Anti-ALYREF Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
Mouse Fibroblast growth factor 23 ELISA Kit
MBS2881372-01 48 Well

Mouse Fibroblast growth factor 23 ELISA Kit

Sign In for Pricing
View Details
Mouse Fibroblast growth factor 23 ELISA Kit
MBS2881372-02 96 Well

Mouse Fibroblast growth factor 23 ELISA Kit

Sign In for Pricing
View Details
Mouse Fibroblast growth factor 23 ELISA Kit
MBS2881372-03 5x 96 Well

Mouse Fibroblast growth factor 23 ELISA Kit

Sign In for Pricing
View Details
Mouse Fibroblast growth factor 23 ELISA Kit
MBS2881372-04 10x 96 Well

Mouse Fibroblast growth factor 23 ELISA Kit

Sign In for Pricing
View Details
1 (2h) -Phthalazinone 98%
P17705-01 25 g

1 (2h) -Phthalazinone 98%

Sign In for Pricing
View Details