CTTN Peptide - middle region
CTTN Peptide - middle region
Product Specifications
Product Name Alternative
EMS1
UniProt
Q14247
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CTTN Rabbit Polyclonal Antibody (orb588590) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HYPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
DZ41404-Biotin 200 µL/Vial
Anti-Venom PLA2 Antibody (Biotine Conjugate)
Sign In for Pricing
View Details MBS6213611-01 0.1 mL
RFWD3 (RING Finger and WD Repeat Domain-containing Protein 3, E3 Ubiquitin-protein Ligase RFWD3, RING Finger Protein 201, RNF201) (MaxLight 550)
Sign In for Pricing
View Details MBS6213611-02 5x 0.1 mL
RFWD3 (RING Finger and WD Repeat Domain-containing Protein 3, E3 Ubiquitin-protein Ligase RFWD3, RING Finger Protein 201, RNF201) (MaxLight 550)
Sign In for Pricing
View Details