ENO2 Peptide - C-terminal region
ENO2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
NSE, HEL-S-279
UniProt
P09104
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ENO2 Rabbit Polyclonal Antibody (orb327454) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001966
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LDFKSPTDPSRYITGDQLGALYQDFVRDYPVVSIEDPFDQDDWAAWSKFT
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1412162-01 0.02 mg (E-Coli)
Recombinant Arabidopsis thaliana GDSL esterase/lipase At3g14220 (At3g14220)
Sign In for Pricing
View Details 
MBS1412162-02 0.02 mg (Yeast)
Recombinant Arabidopsis thaliana GDSL esterase/lipase At3g14220 (At3g14220)
Sign In for Pricing
View Details 
MBS1412162-03 0.1 mg (E-Coli)
Recombinant Arabidopsis thaliana GDSL esterase/lipase At3g14220 (At3g14220)
Sign In for Pricing
View Details MBS1412162-04 0.1 mg (Yeast)
Recombinant Arabidopsis thaliana GDSL esterase/lipase At3g14220 (At3g14220)
Sign In for Pricing
View Details MBS1412162-05 0.02 mg (Baculovirus)
Recombinant Arabidopsis thaliana GDSL esterase/lipase At3g14220 (At3g14220)
Sign In for Pricing
View Details MBS1412162-06 0.02 mg (Mammalian-Cell)
Recombinant Arabidopsis thaliana GDSL esterase/lipase At3g14220 (At3g14220)
Sign In for Pricing
View Details