Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPHA5 Peptide - N-terminal region

EPHA5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EPHA5, BSK, EHK1, HEK7, TYRO4

UniProt

P54756

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPHA5 Rabbit Polyclonal Antibody (orb588592) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IELKFTLRDCNSLPGGLGTCKETFNMYYFESDDQNGRNIKENQYIKIDTI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Phospho-MAP2K1/MAP2K2-(S217/S221) antibody
STJ22236 100 µl

Anti-Phospho-MAP2K1/MAP2K2-(S217/S221) antibody

Sign In for Pricing
View Details
mmu-miR-3113-3p miRNA Agomir
MBS8314103-01 5 nmol

mmu-miR-3113-3p miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-3113-3p miRNA Agomir
MBS8314103-02 10 nmol

mmu-miR-3113-3p miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-3113-3p miRNA Agomir
MBS8314103-03 20 nmol

mmu-miR-3113-3p miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-3113-3p miRNA Agomir
MBS8314103-04 5x 20 nmol

mmu-miR-3113-3p miRNA Agomir

Sign In for Pricing
View Details
AJUBA (NM_032876) Human Recombinant Protein
E45H39340M5 20 µg

AJUBA (NM_032876) Human Recombinant Protein

Sign In for Pricing
View Details