Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERF Peptide - C-terminal region

ERF Peptide - C-terminal region

Product Specifications

Product Name Alternative

ERF

UniProt

P50548

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ERF Rabbit Polyclonal Antibody (orb588596) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MPLKLRFKRRWSEDCRLEGGGGPAGGFEDEGEDKKVRGEGPGEAGGPLTP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLRK1 (NKG2-D Type II Integral Membrane Protein, Killer Cell Lectin-like Receptor Subfamily K, Member 1)
484431 100 µL

KLRK1 (NKG2-D Type II Integral Membrane Protein, Killer Cell Lectin-like Receptor Subfamily K, Member 1)

Sign In for Pricing
View Details
MEKKK 4 Antibody
orb127037-01 25 µg

MEKKK 4 Antibody

Sign In for Pricing
View Details
MEKKK 4 Antibody
orb127037-02 50 µg

MEKKK 4 Antibody

Sign In for Pricing
View Details
MEKKK 4 Antibody
orb127037-03 100 µg

MEKKK 4 Antibody

Sign In for Pricing
View Details
MEKKK 4 Antibody
orb127037-04 200 µg

MEKKK 4 Antibody

Sign In for Pricing
View Details
Recombinant Sodium/potassium Transporting ATPase Subunit Beta-3 (ATP1b3)
TRV-0014454-01 10 µg

Recombinant Sodium/potassium Transporting ATPase Subunit Beta-3 (ATP1b3)

Sign In for Pricing
View Details