ERF Peptide - C-terminal region
ERF Peptide - C-terminal region
Product Specifications
Product Name Alternative
ERF
UniProt
P50548
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ERF Rabbit Polyclonal Antibody (orb588596) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MPLKLRFKRRWSEDCRLEGGGGPAGGFEDEGEDKKVRGEGPGEAGGPLTP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680721-100 1x 100 µL
VEGFR2 / Flk-1 / KDR3 / CD309 (KDR721), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741761-500 1x 500 µL
MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1761R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
