EYA2 Peptide - middle region
EYA2 Peptide - middle region
Product Specifications
Product Name Alternative
EYA2, EAB1
UniProt
O00167
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EYA2 Rabbit Polyclonal Antibody (orb588598) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_742108
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GRSKRSSDPSPAGDNEIERVFVWDLDETIIIFHSLLTGTFASRYGKDTTT
More Discoveries
Explore Other Products
Browse additional items from our catalog
LS284912-20ug 20 µg
LOC284912 (NM_203375) Human Over-expression Lysate
Sign In for Pricing
View Details 
A32267-2-Dylight594 100 µg
Anti-ATP5F1A Antibody Picoband®, Dylight594 Conjugate
Sign In for Pricing
View Details 
DZ41501-PE 200 µL/Vial
Anti-Fruit fly Yippee Antibody, PE Conjugate
Sign In for Pricing
View Details 
MBS711147-01 0.1 mL
Rabbit anti-human BTB and CNC homology 1, basic leucine zipper transcription factor 1 polyclonal Antibody
Sign In for Pricing
View Details MBS711147-02 5x 0.1 mL
Rabbit anti-human BTB and CNC homology 1, basic leucine zipper transcription factor 1 polyclonal Antibody
Sign In for Pricing
View Details