Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBP1 Peptide - C-terminal region

FBP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FBP

UniProt

P09467

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FBP1 Rabbit Polyclonal Antibody (orb327455) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001121100

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KIKKKGKIYSLNEGYARDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVA

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mitapivat
C11958-5mg 5 mg

Mitapivat

Sign In for Pricing
View Details
TMEM17 Protein Vector (Human) (pPM-C-His)
PV042664 500 ng

TMEM17 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Mouse Monoclonal TLR3 Antibody (40C1285.6)
NBP2-24875SS 0.025 mg

Mouse Monoclonal TLR3 Antibody (40C1285.6)

Sign In for Pricing
View Details
Strain Anka SERA3 Antibody PE Conjugated
orb3157940 200 µL

Strain Anka SERA3 Antibody PE Conjugated

Sign In for Pricing
View Details
High HAMA Serum
S2010006B-01 1 Each

High HAMA Serum

Sign In for Pricing
View Details
High HAMA Serum
S2010006B-02 1 mL

High HAMA Serum

Sign In for Pricing
View Details