FBP1 Peptide - C-terminal region
FBP1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
FBP
UniProt
P09467
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FBP1 Rabbit Polyclonal Antibody (orb327455) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001121100
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KIKKKGKIYSLNEGYARDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVA
More Discoveries
Explore Other Products
Browse additional items from our catalog
KLB0147 96 Well
Bovine Tubulin polymerization-promoting Protein family member 3, TPPP3 GENLISA ELISA
Sign In for Pricing
View Details GTR10358940 96 Well
Chicken RNA polymerase II associated protein 3 (RPAP3) ELISA Kit
Sign In for Pricing
View Details