Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FXN Peptide - C-terminal region

FXN Peptide - C-terminal region

Product Specifications

Product Name Alternative

FA, X25, CyaY, FARR, FRDA

UniProt

Q16595

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIST1H1B (Ab-17) Antibody
A77717-100UL 100 µL

HIST1H1B (Ab-17) Antibody

Sign In for Pricing
View Details
1-Bromo-5-fluoro-4-methoxy-2- (trifluoromethyl) benzene
PC1014577-01 250 mg

1-Bromo-5-fluoro-4-methoxy-2- (trifluoromethyl) benzene

Sign In for Pricing
View Details
1-Bromo-5-fluoro-4-methoxy-2- (trifluoromethyl) benzene
PC1014577-02 500 mg

1-Bromo-5-fluoro-4-methoxy-2- (trifluoromethyl) benzene

Sign In for Pricing
View Details
1-Bromo-5-fluoro-4-methoxy-2- (trifluoromethyl) benzene
PC1014577-03 1 g

1-Bromo-5-fluoro-4-methoxy-2- (trifluoromethyl) benzene

Sign In for Pricing
View Details
1-Bromo-5-fluoro-4-methoxy-2- (trifluoromethyl) benzene
PC1014577-04 5 g

1-Bromo-5-fluoro-4-methoxy-2- (trifluoromethyl) benzene

Sign In for Pricing
View Details
PARD6A (Partitioning Defective 6 Homolog alpha, PAR6, PAR6C, TAX40, PAR-6A, TIP-40, PAR6alpha) (MaxLight 650)
MBS6430541-01 0.1 mL

PARD6A (Partitioning Defective 6 Homolog alpha, PAR6, PAR6C, TAX40, PAR-6A, TIP-40, PAR6alpha) (MaxLight 650)

Sign In for Pricing
View Details