What is the catalog number for FXN Peptide - C-terminal region?

The catalog number for FXN Peptide - C-terminal region is orb2001733.

What sizes are available for FXN Peptide - C-terminal region?

FXN Peptide - C-terminal region is available in the following size(s): 100 µg.

Is FXN Peptide - C-terminal region in stock?

FXN Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

FXN Peptide - C-terminal region

Product Specifications

Product Name Alternative

FA, X25, CyaY, FARR, FRDA

UniProt

Q16595

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMM19267V 100 µL

Transaldolase 1 (TALDO1) Mouse Monoclonal Antibody [Clone ID: LBI2E4]

Sign In for Pricing

View Details

70R-10515 50 ug

CAV2 antibody

Sign In for Pricing

View Details

AMM81693-01 1 Each

TTF1 Mouse Monoclonal Antibody

Sign In for Pricing

View Details

AMM81693-02 50 µL

TTF1 Mouse Monoclonal Antibody

Sign In for Pricing

View Details

AMM81693-03 100 µL

TTF1 Mouse Monoclonal Antibody

Sign In for Pricing

View Details

ARG33360 1 Million

HMGB2 Knockout HT29 Polyclonal Cells

Sign In for Pricing

View Details