Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FRG1 Peptide - N-terminal region

FRG1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FRG1

UniProt

Q14331

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FRG1 Rabbit Polyclonal Antibody (orb331509) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004468

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GTKTKSKKKKSKDKKRKREEDEETQLDIVGIWWTVTNFGEISGTIAIEMD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAR4 Polyclonal Antibody
RA28515-01 50 µL

PAR4 Polyclonal Antibody

Sign In for Pricing
View Details
PAR4 Polyclonal Antibody
RA28515-02 100 µL

PAR4 Polyclonal Antibody

Sign In for Pricing
View Details
TRNAA12 CRISPR Knock Out 293T Cell Line (Human)
47880141 1x 10^6 Cells / 1.0 mL

TRNAA12 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
TRAF4 (TNF Receptor Associated Factor 4, TNF Receptor-associated Factor 4, TRAF 4, TRAF-4, Cysteine-rich Domain Associated with RING and Traf Domains Protein 1, CART1, Metastatic Lymph Node Gene 62 Protein, MLN 62, MLN62, RING Finger Protein 83, RNF83) (MaxLight 550)
134673-ML550 100 µL

TRAF4 (TNF Receptor Associated Factor 4, TNF Receptor-associated Factor 4, TRAF 4, TRAF-4, Cysteine-rich Domain Associated with RING and Traf Domains Protein 1, CART1, Metastatic Lymph Node Gene 62 Protein, MLN 62, MLN62, RING Finger Protein 83, RNF83) (MaxLight 550)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Holin-like protein CidB (cidB)
orb2912141-01 20 µg

Recombinant Staphylococcus aureus Holin-like protein CidB (cidB)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Holin-like protein CidB (cidB)
orb2912141-02 100 µg

Recombinant Staphylococcus aureus Holin-like protein CidB (cidB)

Sign In for Pricing
View Details