Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FRG1 Peptide - N-terminal region

FRG1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FRG1

UniProt

Q14331

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FRG1 Rabbit Polyclonal Antibody (orb331509) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004468

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GTKTKSKKKKSKDKKRKREEDEETQLDIVGIWWTVTNFGEISGTIAIEMD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JAM-C Mouse mAb
orb2716817-01 50 µL

JAM-C Mouse mAb

Sign In for Pricing
View Details
JAM-C Mouse mAb
orb2716817-02 100 µL

JAM-C Mouse mAb

Sign In for Pricing
View Details
Osimertinib dimesylate
T10433-01 2 mg

Osimertinib dimesylate

Sign In for Pricing
View Details
Osimertinib dimesylate
T10433-02 5 mg

Osimertinib dimesylate

Sign In for Pricing
View Details
Osimertinib dimesylate
T10433-03 10 mg

Osimertinib dimesylate

Sign In for Pricing
View Details
Fetoprotein, alpha (Alpha Fetoglobulin, FETA, HPAFP) (BSA & Azide Free) (MaxLight 490)
MBS6204659-01 0.1 mL

Fetoprotein, alpha (Alpha Fetoglobulin, FETA, HPAFP) (BSA & Azide Free) (MaxLight 490)

Sign In for Pricing
View Details