Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FUT4 Peptide - middle region

FUT4 Peptide - middle region

Product Specifications

Product Name Alternative

FUT4, ELFT, FCT3A

UniProt

P22083

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FUT4 Rabbit Polyclonal Antibody (orb588604) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002024

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WASPTPSRPVGVLLWWEPFGGRDSAPRPPPDCRLRFNISGCRLLTDRASY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAP2 Antibody
abx234693 100 µg

LAP2 Antibody

Sign In for Pricing
View Details
BPTDS-30-390 AF Systems Consumables
019306 Box of 3000 Plug-in Card

BPTDS-30-390 AF Systems Consumables

Sign In for Pricing
View Details
CCDC172 siRNA (Human)
orb1850648-01 15 nmol

CCDC172 siRNA (Human)

Sign In for Pricing
View Details
CCDC172 siRNA (Human)
orb1850648-02 30 nmol

CCDC172 siRNA (Human)

Sign In for Pricing
View Details
DNAJC15 Recombinant Antibody
bsm-61157R-TR 20 µL

DNAJC15 Recombinant Antibody

Sign In for Pricing
View Details
(S) -tert-Butyl 2- (bromomethyl) morpholine-4-carboxylate
ULB28671 2.5 g

(S) -tert-Butyl 2- (bromomethyl) morpholine-4-carboxylate

Sign In for Pricing
View Details