GABRB2 Peptide - N-terminal region
GABRB2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
ICEE2
UniProt
P47870
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GABRB2 Rabbit Polyclonal Antibody (orb327458) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_068711
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVAD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AN301407L-01 50 µL
Recombinant Histone H3 (Acetyl Lys4) Monoclonal Antibody
Sign In for Pricing
View Details AN301407L-02 100 µL
Recombinant Histone H3 (Acetyl Lys4) Monoclonal Antibody
Sign In for Pricing
View Details 
E3100 1 Each
Accuris™ Compact UV Transilluminator, 16.5x13.5cm, 115V
Sign In for Pricing
View Details