GABRB2 Peptide - N-terminal region
GABRB2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
ICEE2
UniProt
P47870
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GABRB2 Rabbit Polyclonal Antibody (orb327458) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_068711
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVAD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC402884-500 1x 500 µL
CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400046-500 1x 500 µL
Pgp9.5 (UCHL-1) (31A3), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC683219-100 1x 100 µL
Glycophorin A / CD235a (Erythrocyte Marker) (GYPA/3219R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881366-100 1x 100 µL
Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1366), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 