GALNT2 Peptide - middle region
GALNT2 Peptide - middle region
Product Specifications
Product Name Alternative
GalNAc-T2
UniProt
Q10471
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GALNT2 Rabbit Polyclonal Antibody (orb327459) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_004472
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
CGN5K-5-1 1 Kit
5nm NHS-Activated Gold Nanoparticle Conjugation Kit (3 Reactions)
Sign In for Pricing
View Details 
GTR15269106 1 Vial
Lentiviral mouse Zfp382 shRNA (UAS) - Lentiviral mouse Zfp382 shRNA (UAS) (100)
Sign In for Pricing
View Details GTR15098766 1 Vial
Lentiviral human ADGRA2 shRNA (UAS) - Lentiviral human ADGRA2 shRNA (UAS) (100)
Sign In for Pricing
View Details MBS1024665-01 0.5 mg (E-Coli)
Recombinant Rat Killer cell lectin-like receptor subfamily B member 1B allele A (Klrb1b), partial
Sign In for Pricing
View Details MBS1024665-02 0.05 mg (Baculovirus)
Recombinant Rat Killer cell lectin-like receptor subfamily B member 1B allele A (Klrb1b), partial
Sign In for Pricing
View Details