Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALNT2 Peptide - middle region

GALNT2 Peptide - middle region

Product Specifications

Product Name Alternative

GalNAc-T2

UniProt

Q10471

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GALNT2 Rabbit Polyclonal Antibody (orb327459) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004472

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RABGGTA Antibody, Biotin conjugated
CSB-PA852898LD01HU-01 50 µg

RABGGTA Antibody, Biotin conjugated

Sign In for Pricing
View Details
RABGGTA Antibody, Biotin conjugated
CSB-PA852898LD01HU-02 100 µg

RABGGTA Antibody, Biotin conjugated

Sign In for Pricing
View Details
CHPT1 Antibody Blocking peptide
orb1460636 500 µg

CHPT1 Antibody Blocking peptide

Sign In for Pricing
View Details
Human SHISA7 Knockout A549 cell line
GTR15402673 1 Vial

Human SHISA7 Knockout A549 cell line

Sign In for Pricing
View Details
PDHX (PDX1) discontinued
512621 100 µg

PDHX (PDX1) discontinued

Sign In for Pricing
View Details
COL5A3 discontinued
534929-01 30ul

COL5A3 discontinued

Sign In for Pricing
View Details