GCNT2 Peptide - N-terminal region
GCNT2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
II, CCAT, IGNT, ULG3, GCNT5, GCNT2C, NACGT1, NAGCT1, CTRCT13, bA421M1.1, bA360O19.2
UniProt
Q8NFS9
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GCNT2 Rabbit Polyclonal Antibody (orb327460) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_663630
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MNFWRYCFFAFTLLSVVIFVRFYSSQLSPPKSYEKLNSSSERYFRKTACN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BCFHR-201 1 Unit
Floor Type High Speed Refrigerated Centrifuge BCFHR-201
Sign In for Pricing
View Details 
PKSV030392 100 µg
Recombinant SARS-CoV-2 Spike S1+S2 ECD (D614G) (His Tag)
Sign In for Pricing
View Details 
