Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCNT2 Peptide - N-terminal region

GCNT2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

II, CCAT, IGNT, ULG3, GCNT5, GCNT2C, NACGT1, NAGCT1, CTRCT13, bA421M1.1, bA360O19.2

UniProt

Q8NFS9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GCNT2 Rabbit Polyclonal Antibody (orb327460) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_663630

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MNFWRYCFFAFTLLSVVIFVRFYSSQLSPPKSYEKLNSSSERYFRKTACN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDGF Receptor alpha (PDGFRA) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A11]
TA807656BM 100 µL

PDGF Receptor alpha (PDGFRA) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A11]

Sign In for Pricing
View Details
Recombinant pTau217 Antibody (HRP)
RH-023-01 50 μL

Recombinant pTau217 Antibody (HRP)

Sign In for Pricing
View Details
Recombinant pTau217 Antibody (HRP)
RH-023-02 100 µL

Recombinant pTau217 Antibody (HRP)

Sign In for Pricing
View Details
Recombinant pTau217 Antibody (HRP)
RH-023-03 1 mL

Recombinant pTau217 Antibody (HRP)

Sign In for Pricing
View Details
Texas Red Conjugated Glechoma hederacea Lectin (ground ivy) -GHA-
T-9003-1 1 mg

Texas Red Conjugated Glechoma hederacea Lectin (ground ivy) -GHA-

Sign In for Pricing
View Details
Cystatin SN (CST1) Human Gene Knockout Kit (CRISPR)
KN402896 1 Kit

Cystatin SN (CST1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details