Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF10 Peptide - C-terminal region

GDF10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BIP, BMP3B, BMP-3b

UniProt

P55107

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GDF10 Rabbit Polyclonal Antibody (orb327461) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004953

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPGLDERPPRAHAQHFHKHQLWPSPFRALKPRPGRKDRRKKGQEVFMAAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Separase (phospho Ser801) Polyclonal Antibody
E20-60872 100 µg

Separase (phospho Ser801) Polyclonal Antibody

Sign In for Pricing
View Details
Human HSP-70/HSPA9 (HeatShock Protein 70) ELISA Kit
EK244010 96 Well

Human HSP-70/HSPA9 (HeatShock Protein 70) ELISA Kit

Sign In for Pricing
View Details
T220-6005, T-connector, with 200
1211539 1 Unit

T220-6005, T-connector, with 200

Sign In for Pricing
View Details
Recombinant Human PNISR Protein
E30P2559 20 µg

Recombinant Human PNISR Protein

Sign In for Pricing
View Details
Thioredoxin 2/TXN2 Mouse Monoclonal Antibody (APC)
orb2606787 100 µg

Thioredoxin 2/TXN2 Mouse Monoclonal Antibody (APC)

Sign In for Pricing
View Details
NTRK2 Antibody
orb1338535 100 µg

NTRK2 Antibody

Sign In for Pricing
View Details