Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF10 Peptide - C-terminal region

GDF10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BIP, BMP3B, BMP-3b

UniProt

P55107

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GDF10 Rabbit Polyclonal Antibody (orb327461) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004953

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPGLDERPPRAHAQHFHKHQLWPSPFRALKPRPGRKDRRKKGQEVFMAAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal gamma-glutamyl hydrolase Antibody [DyLight 550]
NBP3-06418R 0.1 mL

Rabbit Polyclonal gamma-glutamyl hydrolase Antibody [DyLight 550]

Sign In for Pricing
View Details
Boc- (R) -3-amino-3- (4-chlorophenyl) propionic Acid
443108-01 25 mg

Boc- (R) -3-amino-3- (4-chlorophenyl) propionic Acid

Sign In for Pricing
View Details
Boc- (R) -3-amino-3- (4-chlorophenyl) propionic Acid
443108-02 50 mg

Boc- (R) -3-amino-3- (4-chlorophenyl) propionic Acid

Sign In for Pricing
View Details
HMG2L1 (HMGXB4) (AL079310) Human Untagged Clone
SC313703 10 µg

HMG2L1 (HMGXB4) (AL079310) Human Untagged Clone

Sign In for Pricing
View Details
Human TREML2 shRNA Plasmid
abx962622-01 150 µg

Human TREML2 shRNA Plasmid

Sign In for Pricing
View Details
Human TREML2 shRNA Plasmid
abx962622-02 300 µg

Human TREML2 shRNA Plasmid

Sign In for Pricing
View Details