Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFPT1 Peptide - N-terminal region

GFPT1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GFPT1, GFAT, GFPT

UniProt

Q06210

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GFPT1 Rabbit Polyclonal Antibody (orb588605) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RWATHGEPSPVNSHPQRSDKNNEFIVIHNGIITNYKDLKKFLESKGYDFE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dipyrrolidinylthiuram Disulfide
TRC-D263053-500MG 500 mg

Dipyrrolidinylthiuram Disulfide

Sign In for Pricing
View Details
CINP Antibody
KC-7342-01 50 μL

CINP Antibody

Sign In for Pricing
View Details
CINP Antibody
KC-7342-02 100 µL

CINP Antibody

Sign In for Pricing
View Details
CINP Antibody
KC-7342-03 1 mL

CINP Antibody

Sign In for Pricing
View Details
Mouse IL-13 (Interleukin 13) ELISA Kit
E-EL-M0727-01 24 Tests

Mouse IL-13 (Interleukin 13) ELISA Kit

Sign In for Pricing
View Details
Mouse IL-13 (Interleukin 13) ELISA Kit
E-EL-M0727-02 48 Tests

Mouse IL-13 (Interleukin 13) ELISA Kit

Sign In for Pricing
View Details