Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFPT1 Peptide - N-terminal region

GFPT1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GFPT1, GFAT, GFPT

UniProt

Q06210

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GFPT1 Rabbit Polyclonal Antibody (orb588605) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RWATHGEPSPVNSHPQRSDKNNEFIVIHNGIITNYKDLKKFLESKGYDFE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTEN (Tumor Suppressor Oncoprotein) (PTEN/2110), CF568 conjugate, 0.1mg/mL
BNC682110-500 1x 500 µL

PTEN (Tumor Suppressor Oncoprotein) (PTEN/2110), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Aquaporin 5 Recombinant Rabbit Monoclonal Antibody [JE05-51]
HA722781 100 µL

Aquaporin 5 Recombinant Rabbit Monoclonal Antibody [JE05-51]

Sign In for Pricing
View Details
Aceclofenac-d4
TRC-A130401-2.5MG 2.5 mg

Aceclofenac-d4

Sign In for Pricing
View Details
Pdgfa (NM_008808) Mouse Tagged ORF Clone
MG201931 10 µg

Pdgfa (NM_008808) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Biotin-Necrosulfonamide Propyl Amide
TRC-B390950-2.5MG 2.5 mg

Biotin-Necrosulfonamide Propyl Amide

Sign In for Pricing
View Details
Cyclic 3-Hydroxy Melatonin
TRC-C782110-10MG 10 mg

Cyclic 3-Hydroxy Melatonin

Sign In for Pricing
View Details