GRIA4 Peptide - middle region
GRIA4 Peptide - middle region
Product Specifications
Product Name Alternative
GRIA4, GLUR4
UniProt
P48058
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GRIA4 Rabbit Polyclonal Antibody (orb331510) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RFIHGGANVTGFQLVDFNTPMVIKLMDRWKKLDQREYPGSETPPKYTSAL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
HA750244 100 µL
Myosin Light Chain 2 Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details 
E-BC-K196-M-01 48 T (32 samples)
5’-Nucleotidase (5'-NT) Activity Assay Kit
Sign In for Pricing
View Details E-BC-K196-M-02 96 T (80 samples)
5’-Nucleotidase (5'-NT) Activity Assay Kit
Sign In for Pricing
View Details 
