Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRIA4 Peptide - middle region

GRIA4 Peptide - middle region

Product Specifications

Product Name Alternative

GRIA4, GLUR4

UniProt

P48058

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRIA4 Rabbit Polyclonal Antibody (orb331510) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RFIHGGANVTGFQLVDFNTPMVIKLMDRWKKLDQREYPGSETPPKYTSAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Breast
CR561194 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
ALS2CR1 (NIF3L1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B7]
TA503616BM 100 µL

ALS2CR1 (NIF3L1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B7]

Sign In for Pricing
View Details
Fascin-1 (FSCN1/416), CF740 conjugate, 0.1mg/mL
BNC740416-500 1x 500 µL

Fascin-1 (FSCN1/416), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LKB1 (STK11) Rabbit Polyclonal Antibody
TA392512 100 µL

LKB1 (STK11) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Thyroxine Sodium Salt
TRC-T425601-1G 1 g

Thyroxine Sodium Salt

Sign In for Pricing
View Details
Fura-8™, pentasodium salt
21058-AAT 1 mg

Fura-8™, pentasodium salt

Sign In for Pricing
View Details