Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRIK2 Peptide - middle region

GRIK2 Peptide - middle region

Product Specifications

Product Name Alternative

GRIK2, GLUR6

UniProt

Q13002

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRIK2 Rabbit Polyclonal Antibody (orb588610) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Bromo-2-iodopyridine
TRC-B687630-25G 25 g

5-Bromo-2-iodopyridine

Sign In for Pricing
View Details
Cytokeratin 8/18 (KRT8/803 + KRT18/835), CF568 conjugate, 0.1mg/mL
BNC680979-100 1x 100 µL

Cytokeratin 8/18 (KRT8/803 + KRT18/835), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
D-Gulose
TRC-G855190-25MG 25 mg

D-Gulose

Sign In for Pricing
View Details
Tissue FFPE Sections, Myometrium
CS800315 5x 5 µm

Tissue FFPE Sections, Myometrium

Sign In for Pricing
View Details
FOLR1 Recombinant Rabbit Monoclonal Antibody [PSH06-93]
HA722768 100 µL

FOLR1 Recombinant Rabbit Monoclonal Antibody [PSH06-93]

Sign In for Pricing
View Details
Abca6 Mouse Gene Knockout Kit (CRISPR)
KN500607 1 Kit

Abca6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details