Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRIK2 Peptide - middle region

GRIK2 Peptide - middle region

Product Specifications

Product Name Alternative

GRIK2, GLUR6

UniProt

Q13002

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRIK2 Rabbit Polyclonal Antibody (orb588610) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZAP70 (ZAP70/528 + 2F3.2), CF640R conjugate, 0.1mg/mL
BNC401137-100 1x 100 µL

ZAP70 (ZAP70/528 + 2F3.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (66.4.C2), CF405S conjugate, 0.1mg/mL
BNC040287-500 1x 500 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (66.4.C2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Saliva/Swab RNA Purification 96-Well Kit Dx
Dx69300 2 Plates

Saliva/Swab RNA Purification 96-Well Kit Dx

Sign In for Pricing
View Details
CD4 Rabbit Monoclonal Antibody
TA422434 100 µL

CD4 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CEP104 Antibody
KC-3310-01 50 μL

CEP104 Antibody

Sign In for Pricing
View Details
CEP104 Antibody
KC-3310-02 100 µL

CEP104 Antibody

Sign In for Pricing
View Details