Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRPR Peptide - N-terminal region

GRPR Peptide - N-terminal region

Product Specifications

Product Name Alternative

GRPR

UniProt

P30550

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRPR Rabbit Polyclonal Antibody (orb588611) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005305

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLLNLEVDHFMHCNISSHSADLPVNDDWSHPGILYVIPAVYGVIILIGLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBL3 (NM_007106) Human Tagged ORF Clone Lentiviral Particle
RC208453L3V 200 µL

UBL3 (NM_007106) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PTL-34-427-GY AF Systems Consumables
018538 Roll of 50 Label(s)

PTL-34-427-GY AF Systems Consumables

Sign In for Pricing
View Details
Myt1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
31344114 3x 1.0 µg

Myt1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
MAS1L Polyclonal Antibody, HRP Conjugated
A59765-050 50 µL

MAS1L Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Anti-MOG antibody
STJ190996 200 µl

Anti-MOG antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Adrenal gland
CS602022 5x 5 µm

Frozen Tissue Sections, Adrenal gland

Sign In for Pricing
View Details