Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRPR Peptide - N-terminal region

GRPR Peptide - N-terminal region

Product Specifications

Product Name Alternative

GRPR

UniProt

P30550

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRPR Rabbit Polyclonal Antibody (orb588611) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005305

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLLNLEVDHFMHCNISSHSADLPVNDDWSHPGILYVIPAVYGVIILIGLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA™ Human Microtubule Associated Protein 2 (MAP2) ELISA
KBH1309 1x 96 Well

GENLISA™ Human Microtubule Associated Protein 2 (MAP2) ELISA

Sign In for Pricing
View Details
Tcf3 (NM_001164147) Mouse Tagged ORF Clone Lentiviral Particle
MR225776L3V 200 µL

Tcf3 (NM_001164147) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CNTN5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
16518066 1.0 µg DNA

CNTN5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
GABRB1 Conjugated Antibody
orb1621532 100 µL

GABRB1 Conjugated Antibody

Sign In for Pricing
View Details
Mouse Myl7 ELISA KIT
ELI-38536m 96 Tests

Mouse Myl7 ELISA KIT

Sign In for Pricing
View Details
PKIG Human Over-expression Lysate
orb1374985 20 µg

PKIG Human Over-expression Lysate

Sign In for Pricing
View Details