Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTM1 Peptide - middle region

GSTM1 Peptide - middle region

Product Specifications

Product Name Alternative

GSTM1, GST1

UniProt

P09488

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GSTM1 Rabbit Polyclonal Antibody (orb588612) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Periplakin (PPL) (NM_002705) Human Over-expression Lysate
LY419155 100 µg

Periplakin (PPL) (NM_002705) Human Over-expression Lysate

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD146 Antibody[P1H12]
AN00323G-01 20 Tests

PE/Cyanine5 Anti-Human CD146 Antibody[P1H12]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD146 Antibody[P1H12]
AN00323G-02 100 Tests

PE/Cyanine5 Anti-Human CD146 Antibody[P1H12]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD146 Antibody[P1H12]
AN00323G-03 2x 100 Tests

PE/Cyanine5 Anti-Human CD146 Antibody[P1H12]

Sign In for Pricing
View Details
Tissue Total RNA, Brain
CR559085 5 µg

Tissue Total RNA, Brain

Sign In for Pricing
View Details
Recombinant Human Chymotrypsin C Protein (His Tag)
PKSH031117 50 µg

Recombinant Human Chymotrypsin C Protein (His Tag)

Sign In for Pricing
View Details