Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTM1 Peptide - middle region

GSTM1 Peptide - middle region

Product Specifications

Product Name Alternative

GSTM1, GST1

UniProt

P09488

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GSTM1 Rabbit Polyclonal Antibody (orb588612) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rnf25 Mouse Gene Knockout Kit (CRISPR)
KN514946 1 Kit

Rnf25 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Amino-2-thiazoline
TRC-A630325-25G 25 g

2-Amino-2-thiazoline

Sign In for Pricing
View Details
Recombinant CD3 zeta (phospho Y142) Antibody
RC-5090-01 50 μL

Recombinant CD3 zeta (phospho Y142) Antibody

Sign In for Pricing
View Details
Recombinant CD3 zeta (phospho Y142) Antibody
RC-5090-02 100 µL

Recombinant CD3 zeta (phospho Y142) Antibody

Sign In for Pricing
View Details
Recombinant CD3 zeta (phospho Y142) Antibody
RC-5090-03 1 mL

Recombinant CD3 zeta (phospho Y142) Antibody

Sign In for Pricing
View Details
1,3-Glyceryl Dilinoleate (>80%)
TRC-G601520-250MG 250 mg

1,3-Glyceryl Dilinoleate (>80%)

Sign In for Pricing
View Details