Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GUCY1A1 Peptide - C-terminal region

GUCY1A1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GUCA3, MYMY6, GC-SA3, GUC1A3, GUCSA3, GUCY1A3

UniProt

Q02108

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GUCY1A1 Rabbit Polyclonal Antibody (orb327463) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_006714260

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DCPGFVFTPRSREELPPNFPSEIPGICHFLDAYQQGTNSKPCFQKKDVED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Ethyl-N-(perfluoro-1-octanesulfonyl) Glycine
TRC-E925518-50MG 50 mg

N-Ethyl-N-(perfluoro-1-octanesulfonyl) Glycine

Sign In for Pricing
View Details
AIMP2 Recombinant Rabbit monoclonal Antibody
HA750654 100 µL

AIMP2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Fluorescent Total Cholesterol Detection Kit
FLCHOL100-2 100 Tests

Fluorescent Total Cholesterol Detection Kit

Sign In for Pricing
View Details
Mouse FGF23 Antibody Pair Set
E-KAB-0355 50 µL & 100 µg

Mouse FGF23 Antibody Pair Set

Sign In for Pricing
View Details
Hexokinase II (HK2) Human Gene Knockout Kit (CRISPR)
KN209482RB 1 Kit

Hexokinase II (HK2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Vmn2r95 Mouse Gene Knockout Kit (CRISPR)
KN519228 1 Kit

Vmn2r95 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details