Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GYS1 Peptide - C-terminal region

GYS1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GYS1, GYS

UniProt

P13807

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GYS1 Rabbit Polyclonal Antibody (orb588615) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002094

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RHSSPHQSEDEEDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SYNPO2L activation kit by CRISPRa
GA112740 1 Kit

Human SYNPO2L activation kit by CRISPRa

Sign In for Pricing
View Details
LC3B (MAP1LC3B) Mouse Monoclonal Antibody [Clone ID: 8H6-6D10-3A4]
TA384700 100 µL

LC3B (MAP1LC3B) Mouse Monoclonal Antibody [Clone ID: 8H6-6D10-3A4]

Sign In for Pricing
View Details
CARD12 (NLRC4) Human Gene Knockout Kit (CRISPR)
KN206757 1 Kit

CARD12 (NLRC4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Herpes Virus 8 (HHV8) (LN53), CF405S conjugate, 0.1mg/mL
BNC041746-500 1x 500 µL

Human Herpes Virus 8 (HHV8) (LN53), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
UBXN6 (NM_025241) Human Recombinant Protein
TP317394 20 µg

UBXN6 (NM_025241) Human Recombinant Protein

Sign In for Pricing
View Details
PC4 (SUB1) (NM_006713) Human Recombinant Protein
TP304999L 1 mg

PC4 (SUB1) (NM_006713) Human Recombinant Protein

Sign In for Pricing
View Details