Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GYS1 Peptide - C-terminal region

GYS1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GYS1, GYS

UniProt

P13807

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GYS1 Rabbit Polyclonal Antibody (orb588615) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002094

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RHSSPHQSEDEEDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JUN Polyclonal Antibody
E-AB-70029-01 60 µL

JUN Polyclonal Antibody

Sign In for Pricing
View Details
JUN Polyclonal Antibody
E-AB-70029-02 120 µL

JUN Polyclonal Antibody

Sign In for Pricing
View Details
JUN Polyclonal Antibody
E-AB-70029-03 200 µL

JUN Polyclonal Antibody

Sign In for Pricing
View Details
CLCN1 (NM_000083) Human Over-expression Lysate
LY424940 100 µg

CLCN1 (NM_000083) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant HSPA2 Antibody
RC-4673-01 50 μL

Recombinant HSPA2 Antibody

Sign In for Pricing
View Details
Recombinant HSPA2 Antibody
RC-4673-02 100 µL

Recombinant HSPA2 Antibody

Sign In for Pricing
View Details