Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNRNPD Peptide - C-terminal region

HNRNPD Peptide - C-terminal region

Product Specifications

Product Name Alternative

P37, AUF1, AUF1A, HNRPD, hnRNPD0

UniProt

Q14103

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HNRNPD Rabbit Polyclonal Antibody (orb588619) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_112738

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Treponema denticola Queuine tRNA-ribosyltransferase (tgt)
MBS1339660-01 0.02 mg (E-Coli)

Recombinant Treponema denticola Queuine tRNA-ribosyltransferase (tgt)

Sign In for Pricing
View Details
Recombinant Treponema denticola Queuine tRNA-ribosyltransferase (tgt)
MBS1339660-02 0.02 mg (Yeast)

Recombinant Treponema denticola Queuine tRNA-ribosyltransferase (tgt)

Sign In for Pricing
View Details
Recombinant Treponema denticola Queuine tRNA-ribosyltransferase (tgt)
MBS1339660-03 0.1 mg (E-Coli)

Recombinant Treponema denticola Queuine tRNA-ribosyltransferase (tgt)

Sign In for Pricing
View Details
Recombinant Treponema denticola Queuine tRNA-ribosyltransferase (tgt)
MBS1339660-04 0.1 mg (Yeast)

Recombinant Treponema denticola Queuine tRNA-ribosyltransferase (tgt)

Sign In for Pricing
View Details
Recombinant Treponema denticola Queuine tRNA-ribosyltransferase (tgt)
MBS1339660-05 0.02 mg (Baculovirus)

Recombinant Treponema denticola Queuine tRNA-ribosyltransferase (tgt)

Sign In for Pricing
View Details
Recombinant Treponema denticola Queuine tRNA-ribosyltransferase (tgt)
MBS1339660-06 0.02 mg (Mammalian-Cell)

Recombinant Treponema denticola Queuine tRNA-ribosyltransferase (tgt)

Sign In for Pricing
View Details