Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNRNPD Peptide - C-terminal region

HNRNPD Peptide - C-terminal region

Product Specifications

Product Name Alternative

P37, AUF1, AUF1A, HNRPD, hnRNPD0

UniProt

Q14103

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HNRNPD Rabbit Polyclonal Antibody (orb588619) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_112738

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TH (phospho Ser62) Rabbit Polyclonal Antibody
APRab05552-01 20 µL

TH (phospho Ser62) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TH (phospho Ser62) Rabbit Polyclonal Antibody
APRab05552-02 50 µL

TH (phospho Ser62) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TH (phospho Ser62) Rabbit Polyclonal Antibody
APRab05552-03 100 µL

TH (phospho Ser62) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TH (phospho Ser62) Rabbit Polyclonal Antibody
APRab05552-04 200 µL

TH (phospho Ser62) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse mmu-miR-344i miRNA Antagomir
abx888949-01 10 nmol

Mouse mmu-miR-344i miRNA Antagomir

Sign In for Pricing
View Details
Mouse mmu-miR-344i miRNA Antagomir
abx888949-02 20 nmol

Mouse mmu-miR-344i miRNA Antagomir

Sign In for Pricing
View Details