Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOF Peptide - middle region

APOF Peptide - middle region

Product Specifications

Product Name Alternative

LTIP, Apo-F

UniProt

Q13790

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001629.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AALKPALRSGVQQLIQYYQDQKDANISQPETTKEGLRAISDVSDLEETTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAZ (WWTR1) Rabbit Polyclonal Antibody
TA368080 100 µL

TAZ (WWTR1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ENSA Polyclonal Antibody
E-AB-18885-01 20 µL

ENSA Polyclonal Antibody

Sign In for Pricing
View Details
ENSA Polyclonal Antibody
E-AB-18885-02 60 µL

ENSA Polyclonal Antibody

Sign In for Pricing
View Details
ENSA Polyclonal Antibody
E-AB-18885-03 120 µL

ENSA Polyclonal Antibody

Sign In for Pricing
View Details
ENSA Polyclonal Antibody
E-AB-18885-04 200 µL

ENSA Polyclonal Antibody

Sign In for Pricing
View Details
Caspase-5 Antibody
F41059-0.08ML 0.08 mL

Caspase-5 Antibody

Sign In for Pricing
View Details